| RP13323 | |
|
|
|
| ￥1700 | |
|
|
|
|
|
|
| 联系我们 | |
| Description | The cathelicidin anti-microbial peptide LL-37 is involved in the reepithelialization of human skin wounds and is lacking in chronic ulcer epithelium. LL-37(human) is a cathelicidin-derived peptide with antimicrobial and angiogenic activity. |
| Sequence |
{LEU}{LEU}{GLY}{ASP}{PHE}{PHE}{ARG}{LYS}{SER}{LYS}{GLU}{LYS} {ILE}{GLY}{LYS}{GLU}{PHE}{LYS}{ARG}{ILE}{VAL}{GLN}{ARG}{ILE} {LYS}{ASP}{PHE}{LEU}{ARG}{ASN}{LEU}{VAL}{PRO}{ARG}{THR}{GLU} {SER} |
| Sequence Shortening | LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES |
| Molecular Formula | C205H340N60O53 |
| Molecular Weight | 4493.28 |
| Purity | > 95% |
| Solubility | Insoluble in water. Dissolve the peptide in 10% acetonitrile with 0.1% TFA solution. Further dilute with desired buffer. |
| Form | Lyophilized |
| Storage | Store the product at -20°C. Keep container tightly closed. Store in a cool dry place. |
