Products/Services Used | Details | Operation |
---|---|---|
Peptide Synthesis> | Human ELA32 peptide (.98% purity), QRPVNLTMRRKLRKHNCLQRRCMPLHSRVPFP, was purchased from GenScript (Piscataway, NJ); ELA11 (human) and AE11C were chemically synthesized by standard Fmoc strategy and purified to .98% with rp-HPLC as we previously described. | Get A Quote |
Renal ischemia-reperfusion (I/R) injury is the most common cause of AKI, which associates with high mortality and has no effective therapy. ELABELA (ELA) is a newly identified 32-residue hormone peptide highly expressed in adult kidney. To investigate whether ELA has protective effects on renal I/R injury, we administered the mature peptide (ELA32) or the 11-residue furin-cleaved fragment (ELA11) to hypoxia-reperfusion (H/R)-injured or adriamycin-treated renal tubular cells ELA32 and ELA11 significantly inhibited the elevation of the DNA damage response, apoptosis, and inflammation in H/R-injured renal tubular cells and suppressed adriamycin-induced DNA damage response. Similarly, overexpression of E... More