Products/Services Used | Details | Operation |
---|---|---|
Gene Synthesis> | Gene synthesis was performed by Genscript (Genscript, Piscataway, USA) or Eurofins (Eurofins Genomics, Ebersberg, Germany).Fluorescently-labelled peptides ACBD5 WT (FITC-SPGVLTFAIIWPFIAQWLVYLYYQR RRRKL), MUT1 (FITC-SPGVLTFAIIWPFIAQWLVYLYYQRARAKL) and MUT2 (FITC SPGVLTFA IIWPFIAQWLVYLYYQAAAAKL) (Genscript) were used in the assay at a final concentration of 6.7 nM. Note. the C-terminal asparagine was removed to facilitate peptide synthesis. | Get A Quote |
Tail-anchored (TA) proteins contain a single transmembrane domain (TMD) at the C-terminus that anchors them to the membranes of organelles where they mediate critical cellular processes. Accordingly, mutations in genes encoding TA proteins have been identified in a number of severe inherited disorders. Despite the importance of correctly targeting a TA protein to its appropriate membrane, the mechanisms and signals involved are not fully understood. In this study, we identify additional peroxisomal TA proteins, discover more proteins that are present on multiple organelles, and reveal that a combination of TMD hydrophobicity and tail charge determines targeting to distinct organelle locations in mamma... More