Products/Services Used | Details | Operation |
---|---|---|
Peptide Synthesis> | A binding antibody multiplex assay (BAMA) was used as described (67) with the standards above to measure vaginal antibodies to C.1086 gp140 and serum antibodies to peptides representing the consensus C gp120 constant domain 1 (C1; MHEDIISLWDESLKPCVKLTPLCV; Neolabs), V3 loop (cysteine-bonded CTRPNNNTRKSIRIGPGQTFYATGDIIGDIRQAHC; Neolabs), and the C.1086 gp41 immunodominant region (DQQLLGMWGCSGKLIC with cysteines bonded; Genscript). | Get A Quote |
Antibodies and cytotoxic T cells represent 2 arms of host defense against pathogens. We hypothesized that vaccines that induce both high-magnitude CD8+ T cell responses and antibody responses might confer enhanced protection against HIV. To test this hypothesis, we immunized 3 groups of nonhuman primates: (a) Group 1, which includes sequential immunization regimen involving heterologous viral vectors (HVVs) comprising vesicular stomatitis virus, vaccinia virus, and adenovirus serotype 5-expressing SIVmac239 Gag; (b) Group 2, which includes immunization with a clade C HIV-1 envelope (Env) gp140 protein adjuvanted with nanoparticles containing a TLR7/8 agonist (3M-052); and (c) Group 3, which includes... More