Products/Services Used | Details | Operation |
---|---|---|
Peptide Synthesis> | Peptides corresponding to the predicted antimicrobial regions of ModoCath1 (1ModoCath1, N-VKRTKRGARRGL TKVLKKIFGSIVKKAVSKGV-C), ModoCath5 (1ModoCath5, N-WYQLIRTFGNLIHQKYRKLLEAYRKLRD-C), ModoCath6 (1ModoCath6, N-VRRSKRGIKVPSFVKKVLKDVVSESIS-C) and PMAP36 (N-GRFRRLRKKTRKRLKKIGKVLKWIPPIVGSI PLGCG-C) were synthesized via solid-phase peptide synthesis and purified via high-performance liquid chromatography using a commercial service (GenScript, Piscataway Township, NJ, UnitedStates). | Get A Quote |
This study aimed to characterize cathelicidins from the gray short-tailed opossum in silico and experimentally validate their antimicrobial effects against various pathogenic bacteria and West Nile virus (WNV). Genome-wide in silico analysis against the current genome assembly of the gray short-tailed opossum yielded 56 classical antimicrobial peptides (AMPs) from eight different families, among which 19 cathelicidins, namely ModoCath1 - 19, were analyzed in silico to predict their antimicrobial domains and three of which, ModoCath1, -5, and -6, were further experimentally evaluated for their antimicrobial activity, and were found to exhibit a wide spectrum of antimicroial effects against a panel of gram-positi... More