Products/Services Used | Details | Operation |
---|---|---|
Gene Synthesis> | … The selected amino acid sequence (WNPIQQMSINVDNQFNYVPNNIGAMKIVYEKSQLAPRKLY) was then further synthesized (Genscript, Piscataway, New Jersey, USA). In-house indirect ELISA … Prevalence of antibodies to feline parvovirus, calicivirus, herpesvirus, coronavirus … | Get A Quote |
Background: Feline panleukopenia virus (FPV) is an etiologic pathogen of feline panleukopenia that infects all members of Felidae including tigers (Panthera tigris). Vaccination against FPV among wild felid species has long been practiced in zoos worldwide. However, few studies have assessed tiger immune response post-vaccination due to the absence of a serological diagnostic tool. To address these limitations, this study aimed to develop an in-house indirect enzyme-linked immunosorbent assay (ELISA) for the monitoring of tiger antibody levels against the feline panleukopenia vaccine by employing the synthesized subunit capsid protein VP2. An in-house horseradish peroxidase (HRP) conjugated rabbit anti-tiger im... More